(data stored in ACNUC7421 zone)

EMBL: CP002157.PE444

CP002157.PE444       Location/Qualifiers
FT   CDS             479244..480149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00905"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00905"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00181"
FT                   /db_xref="GOA:A4AVF9"
FT                   /db_xref="InterPro:IPR026341"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVF9"
FT                   /protein_id="EAR00181.1"
FT                   /translation="MFPTELRKQGRVYSKLNLFIILGFFNFLQVTYLRSGNLQDCNHNV
FT                   YPISDFYKCDRDNDHFEEFNINLSELKSNLIRNQTDLVVTYHNAGGDLIDFSTGTQFVV
FT                   NQRTIIARVTNIDGCYKETSFKLTLLSPPVAKSLIDIFECESYTLPPIDFHSNYYTGTN
FT                   GTGRRLKEGEIVTVSLTIYIYAVQADCTDESNFDIIIDPAICQEGTVDTNAVFPKFFTP
FT                   NGDNVNDLWKYEPYPENHGIQVDFIEIYDRYGTFIKYLDREKPEWDGSLNGKLLPSSDY
FT                   WFKAKLENGSQHKGHFTLKR"
     MFPTELRKQG RVYSKLNLFI ILGFFNFLQV TYLRSGNLQD CNHNVYPISD FYKCDRDNDH        60
     FEEFNINLSE LKSNLIRNQT DLVVTYHNAG GDLIDFSTGT QFVVNQRTII ARVTNIDGCY       120
     KETSFKLTLL SPPVAKSLID IFECESYTLP PIDFHSNYYT GTNGTGRRLK EGEIVTVSLT       180
     IYIYAVQADC TDESNFDIII DPAICQEGTV DTNAVFPKFF TPNGDNVNDL WKYEPYPENH       240
     GIQVDFIEIY DRYGTFIKYL DREKPEWDGS LNGKLLPSSD YWFKAKLENG SQHKGHFTLK       300
     R                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page