(data stored in ACNUC7421 zone)

EMBL: CP002157.PE445

CP002157.PE445       Location/Qualifiers
FT   CDS             480206..482197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00910"
FT                   /product="excinuclease ABC subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00910"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00182"
FT                   /db_xref="GOA:A4AVG0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVG0"
FT                   /protein_id="EAR00182.1"
FT                   /translation="MKFKVVSEFKPTGDQPEAIRQLEEGINSQEPYQTLLGVTGSGKTF
FT                   SVANVIEKVQRPTLVLAHNKTLAAQLYSEFKQFFPNNAVEYFVSYYDYYQPEAYIPTSG
FT                   LYIEKDLSINEDIEKLRLSATSSLLSGRRDVLVVASVSCLYGIGNPVEFQKNVISIFKN
FT                   QVIARTKLLHMLVQSLYSRTTADFRNGNFRVKGDVVDVFPSYADHAFRIHFFGDEIEEI
FT                   EAFDPFNNNVIEVYENLNIYPANMFVTSPDILQNAIHYIQDDLVHQIDYFKEIGKPLEA
FT                   KRLEERTNFDLEMIRELGYCSGIENYSRYLDGREPGTRPFCLLDYFPDDYLMVIDESHV
FT                   TIPQVHAMYGGDRSRKENLVEYGFRLPAAMDNRPLKFEEFEALQNQVIYVSATPADYEL
FT                   QLCQGVYVEQVIRPTGLLDPIIEVRPSLNQIDDLVEEIQQRVEKDERTLVTTLTKRMAE
FT                   ELTKYLSRINVRCRYIHSDVDTLERVEIMQDLRKGIFDVLIGVNLLREGLDLPEVSLVA
FT                   ILDADKEGFLRSNRSLTQTVGRAARHLNGKAIMYADKITASMQKTIDETNYRREKQIAY
FT                   NTANNVTPKALNKSLDSVLAKNSVSTYHFEKEELRAAEPDMDYLTKEQIEKMIRDKRKA
FT                   MEKAAKELDFMQAAKLRDEIKMLQNQDK"
     MKFKVVSEFK PTGDQPEAIR QLEEGINSQE PYQTLLGVTG SGKTFSVANV IEKVQRPTLV        60
     LAHNKTLAAQ LYSEFKQFFP NNAVEYFVSY YDYYQPEAYI PTSGLYIEKD LSINEDIEKL       120
     RLSATSSLLS GRRDVLVVAS VSCLYGIGNP VEFQKNVISI FKNQVIARTK LLHMLVQSLY       180
     SRTTADFRNG NFRVKGDVVD VFPSYADHAF RIHFFGDEIE EIEAFDPFNN NVIEVYENLN       240
     IYPANMFVTS PDILQNAIHY IQDDLVHQID YFKEIGKPLE AKRLEERTNF DLEMIRELGY       300
     CSGIENYSRY LDGREPGTRP FCLLDYFPDD YLMVIDESHV TIPQVHAMYG GDRSRKENLV       360
     EYGFRLPAAM DNRPLKFEEF EALQNQVIYV SATPADYELQ LCQGVYVEQV IRPTGLLDPI       420
     IEVRPSLNQI DDLVEEIQQR VEKDERTLVT TLTKRMAEEL TKYLSRINVR CRYIHSDVDT       480
     LERVEIMQDL RKGIFDVLIG VNLLREGLDL PEVSLVAILD ADKEGFLRSN RSLTQTVGRA       540
     ARHLNGKAIM YADKITASMQ KTIDETNYRR EKQIAYNTAN NVTPKALNKS LDSVLAKNSV       600
     STYHFEKEEL RAAEPDMDYL TKEQIEKMIR DKRKAMEKAA KELDFMQAAK LRDEIKMLQN       660
     QDK                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page