(data stored in ACNUC7421 zone)

EMBL: CP002157.PE446

CP002157.PE446       Location/Qualifiers
FT   CDS             complement(482301..482726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00915"
FT                   /product="putative heat-shock related protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00915"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00183"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVG1"
FT                   /protein_id="EAR00183.1"
FT                   /translation="MSIIKRNDVLFPSLMNEILKPDWFGGMENHKSNIPAVNIKENEEN
FT                   FELELMVPGRKKEDFLIEINENVLTISSETKSEENIEKGNFTRREFIFTSFKRAFTLPE
FT                   TVDEENIKANYENGILKFSLPKKEEALPKPKRMIELS"
     MSIIKRNDVL FPSLMNEILK PDWFGGMENH KSNIPAVNIK ENEENFELEL MVPGRKKEDF        60
     LIEINENVLT ISSETKSEEN IEKGNFTRRE FIFTSFKRAF TLPETVDEEN IKANYENGIL       120
     KFSLPKKEEA LPKPKRMIEL S                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page