(data stored in ACNUC7421 zone)

EMBL: CP002157.PE447

CP002157.PE447       Location/Qualifiers
FT   CDS             complement(482858..483259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00920"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00184"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVG2"
FT                   /protein_id="EAR00184.1"
FT                   /translation="MSTRKEKLSILSEMIAFARVDNTIKDEEYVFLQSVAQQLDVDEET
FT                   FDSLFNEKVEHIIPKSQADRILQFHRLVLLMNVDNKQDLLEISRIHNIGLSMGLPPSAI
FT                   EQVLSIMHKYPNKIVPPNVLIEIFKAHYN"
     MSTRKEKLSI LSEMIAFARV DNTIKDEEYV FLQSVAQQLD VDEETFDSLF NEKVEHIIPK        60
     SQADRILQFH RLVLLMNVDN KQDLLEISRI HNIGLSMGLP PSAIEQVLSI MHKYPNKIVP       120
     PNVLIEIFKA HYN                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page