(data stored in ACNUC7421 zone)

EMBL: CP002157.PE45

CP002157.PE45        Location/Qualifiers
FT   CDS             complement(58680..59267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16356"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00674"
FT                   /db_xref="GOA:A4ATA4"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATA4"
FT                   /protein_id="EAR00674.1"
FT                   /translation="MKNFFNFLRSKTFLIQIGLALVLSVLLVFLSLRWLNGSTNHGEFV
FT                   EVPDFAKMSVMDMRQAVEDAGLRYEVLDSANFNPEYPRFSIIEQDPKAGNKVKENRKIY
FT                   FTVNPSGYKKVTVPNIIQVTQRNASSMLKAVGLDVQRVSYIDELGKDMVYQIKYKGKYV
FT                   KPGDKLPKTSKIELICGNGSITTRAQIKADSE"
     MKNFFNFLRS KTFLIQIGLA LVLSVLLVFL SLRWLNGSTN HGEFVEVPDF AKMSVMDMRQ        60
     AVEDAGLRYE VLDSANFNPE YPRFSIIEQD PKAGNKVKEN RKIYFTVNPS GYKKVTVPNI       120
     IQVTQRNASS MLKAVGLDVQ RVSYIDELGK DMVYQIKYKG KYVKPGDKLP KTSKIELICG       180
     NGSITTRAQI KADSE                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page