(data stored in ACNUC7421 zone)

EMBL: CP002157.PE452

CP002157.PE452       Location/Qualifiers
FT   CDS             complement(486253..486891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00945"
FT                   /product="ATP-dependent protease La domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00945"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00189"
FT                   /db_xref="GOA:A4AVG7"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVG7"
FT                   /protein_id="EAR00189.1"
FT                   /translation="MQIPLFPLKSIFFPGETVPLHIFEDRYKQLIQDCRNEAITFGIPV
FT                   FIYDQIAYGTEVQLVEIVNTYDSGEMDVVCVGRQVFKILSFENEMNGKLYPGGNVEFLE
FT                   GLNDATDDLKIQVLDGIKELYTLMDVSFTPMALGKFNMYSLIHKIGLSYEQEYQLLQMP
FT                   KESERLEFVSSHLSTTITVLNELDRTKGTIKMNGDFKNFDPLDFEDFKI"
     MQIPLFPLKS IFFPGETVPL HIFEDRYKQL IQDCRNEAIT FGIPVFIYDQ IAYGTEVQLV        60
     EIVNTYDSGE MDVVCVGRQV FKILSFENEM NGKLYPGGNV EFLEGLNDAT DDLKIQVLDG       120
     IKELYTLMDV SFTPMALGKF NMYSLIHKIG LSYEQEYQLL QMPKESERLE FVSSHLSTTI       180
     TVLNELDRTK GTIKMNGDFK NFDPLDFEDF KI                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page