(data stored in ACNUC7421 zone)

EMBL: CP002157.PE457

CP002157.PE457       Location/Qualifiers
FT   CDS             complement(490995..491498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00970"
FT                   /product="FMN-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00970"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00194"
FT                   /db_xref="GOA:A4AVH2"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVH2"
FT                   /protein_id="EAR00194.1"
FT                   /translation="MTISFLLVGFGLPKTVEKKVRKELQRTFQIENFDLSPIQVSDELN
FT                   EELPMKIKGNNFFRISSSDKHLGFMFVDKARSKTAEFDYLVVFDNELAIVHSKVLIYRE
FT                   EYGGEIGSKRWLKQFMGKTGSDRVDHEKNIDGIAGATISVRSMTSSIDDLLQTIGLLQN
FT                   NQIL"
     MTISFLLVGF GLPKTVEKKV RKELQRTFQI ENFDLSPIQV SDELNEELPM KIKGNNFFRI        60
     SSSDKHLGFM FVDKARSKTA EFDYLVVFDN ELAIVHSKVL IYREEYGGEI GSKRWLKQFM       120
     GKTGSDRVDH EKNIDGIAGA TISVRSMTSS IDDLLQTIGL LQNNQIL                     167
//

If you have problems or comments...

PBIL Back to PBIL home page