(data stored in ACNUC7421 zone)

EMBL: CP002157.PE458

CP002157.PE458       Location/Qualifiers
FT   CDS             complement(491631..492809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00975"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00975"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00195"
FT                   /db_xref="InterPro:IPR010870"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVH3"
FT                   /protein_id="EAR00195.1"
FT                   /translation="MKNPILLFAVLFTAFLSAQTVTDSIMLNPQKQLNAAQRLLSGNYA
FT                   SAVTIGAYGEMLYNQPEGDNGELDVQRLVLLMGYRFNEKTQFVTEIEFEHVEEVFVEQA
FT                   FVNYNVGNNVNLRGGLMLVPMGIVNEFHEPTTFNGTERPAMDNVIVPTTWRELGVGVSG
FT                   RFDNLSLGYQAYLFNGFKSTLADGEGGVSGVLKGSNGLRSGRQKGIKSTVDSPNLSTKL
FT                   DYYGIPGLRLGLSTYFGKTQAADEVEEIDGANIGISMIGLDARYAYQRFTARGQFIHAS
FT                   LSDTEDYNALTGRDLGSALQGWYVESAFNLLPTKNQQKLFAFARYEKYDTHASTAGSLT
FT                   KNNAYDKTDITTGLTYHLAPGVVLKGDYQFRSNALDNGDVKDRLNFGIGVWF"
     MKNPILLFAV LFTAFLSAQT VTDSIMLNPQ KQLNAAQRLL SGNYASAVTI GAYGEMLYNQ        60
     PEGDNGELDV QRLVLLMGYR FNEKTQFVTE IEFEHVEEVF VEQAFVNYNV GNNVNLRGGL       120
     MLVPMGIVNE FHEPTTFNGT ERPAMDNVIV PTTWRELGVG VSGRFDNLSL GYQAYLFNGF       180
     KSTLADGEGG VSGVLKGSNG LRSGRQKGIK STVDSPNLST KLDYYGIPGL RLGLSTYFGK       240
     TQAADEVEEI DGANIGISMI GLDARYAYQR FTARGQFIHA SLSDTEDYNA LTGRDLGSAL       300
     QGWYVESAFN LLPTKNQQKL FAFARYEKYD THASTAGSLT KNNAYDKTDI TTGLTYHLAP       360
     GVVLKGDYQF RSNALDNGDV KDRLNFGIGV WF                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page