(data stored in ACNUC7421 zone)

EMBL: CP002157.PE469

CP002157.PE469       Location/Qualifiers
FT   CDS             complement(500811..501725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01030"
FT                   /product="putative N utilization substance protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01030"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00206"
FT                   /db_xref="GOA:A4AVI4"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVI4"
FT                   /protein_id="EAR00206.1"
FT                   /translation="MQCIYALTQSKDESLEKQEKFLKVSIENMYTLYLLMLSLLIEIQQ
FT                   LASNKVELSSKKYLSNSSDSFPDKRKFAKNRLLAKLSDNESLKSELEKRKLKNWYLNEE
FT                   YVKLIYKEIVESDVYAKYMIIPSSTFKDDKEFISTIFKEVIAPNEKIYDYFEDDKLTWV
FT                   DDIPIVNTFILKQLKKVSEDKSDSYFLPRLLKDNEDMDFAQKLLTKTLLNNSKWEKEIE
FT                   GKTPNWDKDRIADIDAILLKMAICELLNFPSIPEKVTINEFLEIAKEYSTPKSSIFING
FT                   ILDKLVKEYKTEGKLKKVGRGLL"
     MQCIYALTQS KDESLEKQEK FLKVSIENMY TLYLLMLSLL IEIQQLASNK VELSSKKYLS        60
     NSSDSFPDKR KFAKNRLLAK LSDNESLKSE LEKRKLKNWY LNEEYVKLIY KEIVESDVYA       120
     KYMIIPSSTF KDDKEFISTI FKEVIAPNEK IYDYFEDDKL TWVDDIPIVN TFILKQLKKV       180
     SEDKSDSYFL PRLLKDNEDM DFAQKLLTKT LLNNSKWEKE IEGKTPNWDK DRIADIDAIL       240
     LKMAICELLN FPSIPEKVTI NEFLEIAKEY STPKSSIFIN GILDKLVKEY KTEGKLKKVG       300
     RGLL                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page