(data stored in ACNUC7421 zone)

EMBL: CP002157.PE470

CP002157.PE470       Location/Qualifiers
FT   CDS             501936..503690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01035"
FT                   /product="ABC transporter, ATP-binding protein, MDR family"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01035"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00207"
FT                   /db_xref="GOA:A4AVI5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVI5"
FT                   /protein_id="EAR00207.1"
FT                   /translation="MKELKHLNKYFKKYWLKLLVGMIITVAAKIFQLIMPSYANKSITV
FT                   VEDFIKGELTQEVAKEMLLEFILIIIGAALLSGFLTFLMRQTIIYVSRYIEYDLKNEIF
FT                   DHYQFLSLNFYKKNRTGDLMNRISEDVSQVRMYSGPALMYGMNTITLFACIIPIMFIKA
FT                   PTLAAYTLIPLPILSVLIYQISKVIHKRSTVVQEYLSSLSTFTQEVFSGVSVIKAYAIE
FT                   PKINAELSALALEGKNKSMDLAKVNAWFFPLMILLIGISNIFVIYIGGQQYINGEIASV
FT                   GLIIEFIIYVNMLTWPVAIVGWLTSIIQRAEASQKRINEFLKVESEITNEVSEETPIKG
FT                   KIEFKNVSFTYDDTNITALRNISFTIKEGQTVAILGKTGSGKSTILDLIARLYDVGSGQ
FT                   ILVDGESLKKLNLNTLRKSIGAVPQDAFLFSDTIKNNIKFGDYDSSDEEVIQVAKNAVV
FT                   HKNIMDFKNQYDTVLGERGITLSGGQKQRVSIARALLKNPQIYLFDDCLSAVDTETEET
FT                   ILNNLQKASSAKTTIIVSHRVSSAKNADKILVLEDGRLLQEGTHEKLNNVEGYYKELYM
FT                   HQLAEKEN"
     MKELKHLNKY FKKYWLKLLV GMIITVAAKI FQLIMPSYAN KSITVVEDFI KGELTQEVAK        60
     EMLLEFILII IGAALLSGFL TFLMRQTIIY VSRYIEYDLK NEIFDHYQFL SLNFYKKNRT       120
     GDLMNRISED VSQVRMYSGP ALMYGMNTIT LFACIIPIMF IKAPTLAAYT LIPLPILSVL       180
     IYQISKVIHK RSTVVQEYLS SLSTFTQEVF SGVSVIKAYA IEPKINAELS ALALEGKNKS       240
     MDLAKVNAWF FPLMILLIGI SNIFVIYIGG QQYINGEIAS VGLIIEFIIY VNMLTWPVAI       300
     VGWLTSIIQR AEASQKRINE FLKVESEITN EVSEETPIKG KIEFKNVSFT YDDTNITALR       360
     NISFTIKEGQ TVAILGKTGS GKSTILDLIA RLYDVGSGQI LVDGESLKKL NLNTLRKSIG       420
     AVPQDAFLFS DTIKNNIKFG DYDSSDEEVI QVAKNAVVHK NIMDFKNQYD TVLGERGITL       480
     SGGQKQRVSI ARALLKNPQI YLFDDCLSAV DTETEETILN NLQKASSAKT TIIVSHRVSS       540
     AKNADKILVL EDGRLLQEGT HEKLNNVEGY YKELYMHQLA EKEN                        584
//

If you have problems or comments...

PBIL Back to PBIL home page