(data stored in ACNUC7421 zone)

EMBL: CP002157.PE474

CP002157.PE474       Location/Qualifiers
FT   CDS             complement(507788..508711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01055"
FT                   /product="bile acid transporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01055"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00211"
FT                   /db_xref="GOA:A4AVI9"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004710"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVI9"
FT                   /protein_id="EAR00211.1"
FT                   /translation="MTETILDNVHINFNSQALWVMNIALALVMFGIALEISVNDFKRLF
FT                   KNPKPIFTGAFSQFLLLPAITFLLVWLIEPIPSIALGMFMVAACPGGNISNFITHLAKG
FT                   NSALSVSLTAVATLLAVFMTPLNLQLWGSMYGPTATILKDVAISPLEMIKLVSLLLAFP
FT                   LVLGMWVNHARPILAKKMAKILKLLSLLFFISLIFLALYNNREIFLDYIFYVFWIVIIH
FT                   NLVAFATGFSIAKIGGLSKKDVRSITIETGIQNSGLGLLLIFTFFEGLGGMALLAAFWG
FT                   IWHLISGLILSAVWGYRPVKKEELVS"
     MTETILDNVH INFNSQALWV MNIALALVMF GIALEISVND FKRLFKNPKP IFTGAFSQFL        60
     LLPAITFLLV WLIEPIPSIA LGMFMVAACP GGNISNFITH LAKGNSALSV SLTAVATLLA       120
     VFMTPLNLQL WGSMYGPTAT ILKDVAISPL EMIKLVSLLL AFPLVLGMWV NHARPILAKK       180
     MAKILKLLSL LFFISLIFLA LYNNREIFLD YIFYVFWIVI IHNLVAFATG FSIAKIGGLS       240
     KKDVRSITIE TGIQNSGLGL LLIFTFFEGL GGMALLAAFW GIWHLISGLI LSAVWGYRPV       300
     KKEELVS                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page