(data stored in ACNUC7421 zone)

EMBL: CP002157.PE476

CP002157.PE476       Location/Qualifiers
FT   CDS             509162..509722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01065"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00213"
FT                   /db_xref="GOA:A4AVJ1"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVJ1"
FT                   /protein_id="EAR00213.1"
FT                   /translation="MANTPSNMLPLGTKAPAFDLMDTVSGKILSLSSLKGEKGTVIMFI
FT                   CNHCPFVIHINPEISKMAKTYQEVGISFVAISSNDVVNYPQDAPHLMKQTAITEGYIFP
FT                   YLYDESQEVAISYEAACTPDIYLFDDNLNLFYRGQLDDSRPGNGLPVTGKDLRSAIEAL
FT                   IHGKEANTIQKPSIGCNIKWFKK"
     MANTPSNMLP LGTKAPAFDL MDTVSGKILS LSSLKGEKGT VIMFICNHCP FVIHINPEIS        60
     KMAKTYQEVG ISFVAISSND VVNYPQDAPH LMKQTAITEG YIFPYLYDES QEVAISYEAA       120
     CTPDIYLFDD NLNLFYRGQL DDSRPGNGLP VTGKDLRSAI EALIHGKEAN TIQKPSIGCN       180
     IKWFKK                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page