(data stored in ACNUC7421 zone)

EMBL: CP002157.PE48

CP002157.PE48        Location/Qualifiers
FT   CDS             61133..64132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16371"
FT                   /product="histidine kinase sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16371"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00677"
FT                   /db_xref="GOA:A4ATA7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATA7"
FT                   /protein_id="EAR00677.1"
FT                   /translation="MIKRSQIDPNNYLIKQLPQATAFLNKKLEVVHASDRWINAFDFTD
FT                   RKITGKKINQLLGKSFDSHQKILKECLKGIIHEGRIENHIDENNEEKWFEWIDLPWYDE
FT                   KENIIGVIIQIEDVTQRVLNDLKLAKLEALINVQSETTKTGTWEYDAVKDCLLWCDITK
FT                   DIHEVNTNFEPNIDTAINYYKNGHSRNTISMAFDLAMREGKSWNEKLQIITEKGNEIWV
FT                   IASGQPVFKNNKFIGLIGTFKDINEQVLSDIKTRESEQLLKTLIDNLPINIYVKDINLR
FT                   KILVNKAECEFNGAKNPEELLGKTDFDFLDKKSAQLSADEEYKVMDSLIPILAREDICK
FT                   TKDGKETLFLGSKIPLLNEDNEVAGIIGMSLDITEKRDAEIKLEEKDRYFRSIFNSSYQ
FT                   FTGILDIDGTLLEINDTALDFANKKLEDIVGKKFWDAYWWPIPDFVKGGLKQVVKSAAK
FT                   GEFMRSEIKVLDKDKNPIPVDFSLKPIYNDNNKVVSLLAEGRMITEMVAARDKIKESEQ
FT                   KFRTLYVMSPISFILYDYETGRILDFNPSFENISGYDKTNIDEIVFWDFLKNTNNQNKE
FT                   QINLELENNGAFGPFEEKIINKDGKEYSVIINKSLIVNRKGEKLVWTIIQDISESVKKE
FT                   QQIREERKLLKTLIDNLPLNVYIKDTQSRKILVNQAECDYLGVDSEEELLGKSDFDLYD
FT                   KKTAQEFRNEDLGVISTLKPILGQETIKKKKDGTISTFLSSKIPLKGEDGSVTGLVGIS
FT                   LDISELKQKEEELRGLINVTSLQNKKLLEFAHIVSHNLRSHSANFSMLLEFLINEKNET
FT                   ERNNIIKMLEDASNNLLETLENLNQVLAISTNINLKKKSINLNKKINKVTNKLDGLLKK
FT                   KKVKIYNKISDDVYIPTIPTYVESILVNFITNAIKYKSPKRDPVIKLSTESKNGFTILS
FT                   IEDNGLGIDLKKYGDKLFGMYKTFHNTNGSRGIGLYITKNQIEAMNGKVTVSSTVGSGT
FT                   TFNIYFNEEN"
     MIKRSQIDPN NYLIKQLPQA TAFLNKKLEV VHASDRWINA FDFTDRKITG KKINQLLGKS        60
     FDSHQKILKE CLKGIIHEGR IENHIDENNE EKWFEWIDLP WYDEKENIIG VIIQIEDVTQ       120
     RVLNDLKLAK LEALINVQSE TTKTGTWEYD AVKDCLLWCD ITKDIHEVNT NFEPNIDTAI       180
     NYYKNGHSRN TISMAFDLAM REGKSWNEKL QIITEKGNEI WVIASGQPVF KNNKFIGLIG       240
     TFKDINEQVL SDIKTRESEQ LLKTLIDNLP INIYVKDINL RKILVNKAEC EFNGAKNPEE       300
     LLGKTDFDFL DKKSAQLSAD EEYKVMDSLI PILAREDICK TKDGKETLFL GSKIPLLNED       360
     NEVAGIIGMS LDITEKRDAE IKLEEKDRYF RSIFNSSYQF TGILDIDGTL LEINDTALDF       420
     ANKKLEDIVG KKFWDAYWWP IPDFVKGGLK QVVKSAAKGE FMRSEIKVLD KDKNPIPVDF       480
     SLKPIYNDNN KVVSLLAEGR MITEMVAARD KIKESEQKFR TLYVMSPISF ILYDYETGRI       540
     LDFNPSFENI SGYDKTNIDE IVFWDFLKNT NNQNKEQINL ELENNGAFGP FEEKIINKDG       600
     KEYSVIINKS LIVNRKGEKL VWTIIQDISE SVKKEQQIRE ERKLLKTLID NLPLNVYIKD       660
     TQSRKILVNQ AECDYLGVDS EEELLGKSDF DLYDKKTAQE FRNEDLGVIS TLKPILGQET       720
     IKKKKDGTIS TFLSSKIPLK GEDGSVTGLV GISLDISELK QKEEELRGLI NVTSLQNKKL       780
     LEFAHIVSHN LRSHSANFSM LLEFLINEKN ETERNNIIKM LEDASNNLLE TLENLNQVLA       840
     ISTNINLKKK SINLNKKINK VTNKLDGLLK KKKVKIYNKI SDDVYIPTIP TYVESILVNF       900
     ITNAIKYKSP KRDPVIKLST ESKNGFTILS IEDNGLGIDL KKYGDKLFGM YKTFHNTNGS       960
     RGIGLYITKN QIEAMNGKVT VSSTVGSGTT FNIYFNEEN                              999
//

If you have problems or comments...

PBIL Back to PBIL home page