(data stored in ACNUC7421 zone)

EMBL: CP002157.PE483

CP002157.PE483       Location/Qualifiers
FT   CDS             complement(512905..514305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01100"
FT                   /product="peptidase, M28D family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01100"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00220"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVJ8"
FT                   /protein_id="EAR00220.1"
FT                   /translation="MRFIKLTLIVLLTVWNGFSQSEDEKQIKAIYDAALTKGKAYDWLN
FT                   HLSNQIGGRLSGSVQAQQAVDYTKTQLDSLGVDRVWLQSVMVPKWVRGTPEFAYFETAP
FT                   GITSDVPICALGGSVATPLGGLKANIIEVNGIEQLAKLGKDKIAGKIVFYNKPMDPTLI
FT                   STFQSYSGCVDQRYAGASEAAKFGAVGVIVRSMNLRLDDLPHTGSMSYGDTDASKRIPA
FT                   AAISTNGAELLSTTLKLSPITKFYFKQNCKQFEDVESFNVIGEIQGSKYPNEIMIVGGH
FT                   LDSWDLGDGSHDDGAGCVQSMDVLRLLKESGYRPQRTIRVVLFMNEENGLRGGNKYAEV
FT                   AKDKNENHVFALESDAGGFTPRGFSFDCSDSNFEQVQSWKKLFEPYLIHMFVRGGSGAD
FT                   IGPLKNDEMVLAGLRPDSQRYFDHHHAENDTFEHVNKRELELGAATMTSLIYLFDKYGI
FT                   VKPPKIKG"
     MRFIKLTLIV LLTVWNGFSQ SEDEKQIKAI YDAALTKGKA YDWLNHLSNQ IGGRLSGSVQ        60
     AQQAVDYTKT QLDSLGVDRV WLQSVMVPKW VRGTPEFAYF ETAPGITSDV PICALGGSVA       120
     TPLGGLKANI IEVNGIEQLA KLGKDKIAGK IVFYNKPMDP TLISTFQSYS GCVDQRYAGA       180
     SEAAKFGAVG VIVRSMNLRL DDLPHTGSMS YGDTDASKRI PAAAISTNGA ELLSTTLKLS       240
     PITKFYFKQN CKQFEDVESF NVIGEIQGSK YPNEIMIVGG HLDSWDLGDG SHDDGAGCVQ       300
     SMDVLRLLKE SGYRPQRTIR VVLFMNEENG LRGGNKYAEV AKDKNENHVF ALESDAGGFT       360
     PRGFSFDCSD SNFEQVQSWK KLFEPYLIHM FVRGGSGADI GPLKNDEMVL AGLRPDSQRY       420
     FDHHHAENDT FEHVNKRELE LGAATMTSLI YLFDKYGIVK PPKIKG                      466
//

If you have problems or comments...

PBIL Back to PBIL home page