(data stored in ACNUC7421 zone)

EMBL: CP002157.PE484

CP002157.PE484       Location/Qualifiers
FT   CDS             complement(514302..515216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01105"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00221"
FT                   /db_xref="GOA:A4AVJ9"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022300"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVJ9"
FT                   /protein_id="EAR00221.1"
FT                   /translation="MHFNDKIFYIQGMKNVDINAYKAIKDVNLAEIPTFENFGVTDKEL
FT                   KKDLEKIREDLGDFQDTLYAHGKYSVLVCLQGMDTSGKDSLIREVFKDFNVRGVVVHSF
FT                   KVPTELELKHDYIWRHYIALPARGKFGVFNRTHYENVLVTRVHPEYILGENIPSVNSVS
FT                   DIDQKFWDARFEQINNFEKHIVDNGTIVFKFFLHLSKEEQRQRLLRRLRLKEKNWKFSP
FT                   GDLKERKLWEEYQRCYQEAINNTSKEHAPWFVVPADNKKAARVIVAQVLLEELKKYKDI
FT                   VEPELDDKIKANLETYNQQLENE"
     MHFNDKIFYI QGMKNVDINA YKAIKDVNLA EIPTFENFGV TDKELKKDLE KIREDLGDFQ        60
     DTLYAHGKYS VLVCLQGMDT SGKDSLIREV FKDFNVRGVV VHSFKVPTEL ELKHDYIWRH       120
     YIALPARGKF GVFNRTHYEN VLVTRVHPEY ILGENIPSVN SVSDIDQKFW DARFEQINNF       180
     EKHIVDNGTI VFKFFLHLSK EEQRQRLLRR LRLKEKNWKF SPGDLKERKL WEEYQRCYQE       240
     AINNTSKEHA PWFVVPADNK KAARVIVAQV LLEELKKYKD IVEPELDDKI KANLETYNQQ       300
     LENE                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page