(data stored in ACNUC7421 zone)

EMBL: CP002157.PE486

CP002157.PE486       Location/Qualifiers
FT   CDS             complement(516073..517236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01115"
FT                   /product="C4-dicarboxylate transport transcriptional
FT                   regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01115"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00223"
FT                   /db_xref="GOA:A4AVK1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVK1"
FT                   /protein_id="EAR00223.1"
FT                   /translation="MSKILVVEDESAIRRVLVKILSEESDSYQVEEAEDGLRGIEAIKN
FT                   NDYDLVLCDIKMPKMDGVEVLEAASKIKPEIPFIMISGHGDLDTAVNTMRLGAFDYISK
FT                   PPDLNRLLTTVRNALDRKELVVENKILKKKVSKNYEMIGESKEINAIKDIIEKVAPTDA
FT                   RVLVTGSNGTGKELVAHWVHEKSPRSSAPFIEVNCAAIPSELIESELFGHVKGAFTSAV
FT                   KDRAGKFEAANKGTIFLDEIGDMSLSAQAKVLRALQENKISRVGSDKDIKVNVRVIAAT
FT                   NKDLAKEIKENKFREDLYHRLAVILIKVPSLNDRREDIPLLINHFASKIASEQGISPKG
FT                   FSKNAIKLLKGYDWTGNIRELRNVVERLIILGGQEVTEEDVKLFASK"
     MSKILVVEDE SAIRRVLVKI LSEESDSYQV EEAEDGLRGI EAIKNNDYDL VLCDIKMPKM        60
     DGVEVLEAAS KIKPEIPFIM ISGHGDLDTA VNTMRLGAFD YISKPPDLNR LLTTVRNALD       120
     RKELVVENKI LKKKVSKNYE MIGESKEINA IKDIIEKVAP TDARVLVTGS NGTGKELVAH       180
     WVHEKSPRSS APFIEVNCAA IPSELIESEL FGHVKGAFTS AVKDRAGKFE AANKGTIFLD       240
     EIGDMSLSAQ AKVLRALQEN KISRVGSDKD IKVNVRVIAA TNKDLAKEIK ENKFREDLYH       300
     RLAVILIKVP SLNDRREDIP LLINHFASKI ASEQGISPKG FSKNAIKLLK GYDWTGNIRE       360
     LRNVVERLII LGGQEVTEED VKLFASK                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page