(data stored in ACNUC7421 zone)

EMBL: CP002157.PE487

CP002157.PE487       Location/Qualifiers
FT   CDS             complement(517248..518141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01120"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00224"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVK2"
FT                   /protein_id="EAR00224.1"
FT                   /translation="MKITILLKKSIKSIGYILAVCCFQLGNAQSPDIFRLEYMLMPQNK
FT                   AEAELSRFKLVANAPIKVRETDNIILGAEYNYLAYKIGDQAPFDVQGIKNLHVVDFNLA
FT                   YVYKHNEDWRFIGVATPRLSSTLTNSLENGDVSVNVTVGAFKDKQNIEKPMRLVMGIAY
FT                   NSTVALRIPLPIIYFEKKFHPKWTYVIGVPKTGLKHHLKKNHMIQAEFILDGYFVNLQN
FT                   NIILPNTGFASSISSSAALFTMGYQYNISKNMSFYGYVGHTLFQDGVLRDNDRNDIFTL
FT                   NDEPSLYFRTGFRIGI"
     MKITILLKKS IKSIGYILAV CCFQLGNAQS PDIFRLEYML MPQNKAEAEL SRFKLVANAP        60
     IKVRETDNII LGAEYNYLAY KIGDQAPFDV QGIKNLHVVD FNLAYVYKHN EDWRFIGVAT       120
     PRLSSTLTNS LENGDVSVNV TVGAFKDKQN IEKPMRLVMG IAYNSTVALR IPLPIIYFEK       180
     KFHPKWTYVI GVPKTGLKHH LKKNHMIQAE FILDGYFVNL QNNIILPNTG FASSISSSAA       240
     LFTMGYQYNI SKNMSFYGYV GHTLFQDGVL RDNDRNDIFT LNDEPSLYFR TGFRIGI          297
//

If you have problems or comments...

PBIL Back to PBIL home page