(data stored in ACNUC7421 zone)

EMBL: CP002157.PE489

CP002157.PE489       Location/Qualifiers
FT   CDS             complement(519520..520455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01130"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01130"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00226"
FT                   /db_xref="GOA:A4AVK4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVK4"
FT                   /protein_id="EAR00226.1"
FT                   /translation="MNNILVTKEVTKQFGKHIALNKVSLEIPENSIYGLLGPNGAGKTT
FT                   LIRIINQITHPDSGEVYFDGELLKPKHISVIGYLPEERGLYKSMKVGEQALYLAQLKGL
FT                   SKSEAKKRLKYWFEKLDIGDWWNKKVQELSKGMAQKIQFIVTVLHEPKLLIFDEPFSGF
FT                   DPINANIIKDEILNLKENGTSIIFSTHRMESVEELCEYIALIHQSEKILDGKLSNIKKE
FT                   YKNNIYNVGLEVKNPDALLRELSGKFDLTASEINPLENQLDFTVQLPTNDSGEMLTFLA
FT                   NKANVNQFVETIPSANEIFIQTVQSKDANE"
     MNNILVTKEV TKQFGKHIAL NKVSLEIPEN SIYGLLGPNG AGKTTLIRII NQITHPDSGE        60
     VYFDGELLKP KHISVIGYLP EERGLYKSMK VGEQALYLAQ LKGLSKSEAK KRLKYWFEKL       120
     DIGDWWNKKV QELSKGMAQK IQFIVTVLHE PKLLIFDEPF SGFDPINANI IKDEILNLKE       180
     NGTSIIFSTH RMESVEELCE YIALIHQSEK ILDGKLSNIK KEYKNNIYNV GLEVKNPDAL       240
     LRELSGKFDL TASEINPLEN QLDFTVQLPT NDSGEMLTFL ANKANVNQFV ETIPSANEIF       300
     IQTVQSKDAN E                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page