(data stored in ACNUC7421 zone)

EMBL: CP002157.PE495

CP002157.PE495       Location/Qualifiers
FT   CDS             525052..525891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01167"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01167"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99941"
FT                   /db_xref="GOA:A4AVL1"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVL1"
FT                   /protein_id="EAQ99941.1"
FT                   /translation="MKAYKDEKDIVWLFRPLDNCKRLNVSAKRMAIPELPEDYFMDGLV
FT                   ELLNLEKDWIPQSAGSSLYIRPFIFASGNGFHASPADEYTFIIACAPSGAYFSGKVKVL
FT                   IEEKYSRSANGGVGYAKAGGNYAGQFYPTQLAVEKGYNQVIWTDDNTHEYIEEAGAMNI
FT                   FVRINDTLITGPTSDRILDGITRKSILKIAKDEGIPFQVRKITVIEVVEAAKDGSLKEM
FT                   FGAGTAAVISPISTFGYRDTDYDLPEMPEGYATRLKKRITDIQYNRSEDKFGWRYKV"
     MKAYKDEKDI VWLFRPLDNC KRLNVSAKRM AIPELPEDYF MDGLVELLNL EKDWIPQSAG        60
     SSLYIRPFIF ASGNGFHASP ADEYTFIIAC APSGAYFSGK VKVLIEEKYS RSANGGVGYA       120
     KAGGNYAGQF YPTQLAVEKG YNQVIWTDDN THEYIEEAGA MNIFVRINDT LITGPTSDRI       180
     LDGITRKSIL KIAKDEGIPF QVRKITVIEV VEAAKDGSLK EMFGAGTAAV ISPISTFGYR       240
     DTDYDLPEMP EGYATRLKKR ITDIQYNRSE DKFGWRYKV                              279
//

If you have problems or comments...

PBIL Back to PBIL home page