(data stored in ACNUC7421 zone)

EMBL: CP002157.PE496

CP002157.PE496       Location/Qualifiers
FT   CDS             complement(525919..526305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01172"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01172"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99942"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="InterPro:IPR023292"
FT                   /db_xref="InterPro:IPR033653"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVL2"
FT                   /protein_id="EAQ99942.1"
FT                   /translation="MKHKISAVELFHNSFGLGVSETMRANLGKEKNLLRYNLMDEENKE
FT                   YFEAANENDLVEVADALGDMLYILCGTILEHGMQYKIEEVFEEIQRSNMSKLGADGKPI
FT                   YREDGKVLKGPNYFKPNIESILDK"
     MKHKISAVEL FHNSFGLGVS ETMRANLGKE KNLLRYNLMD EENKEYFEAA NENDLVEVAD        60
     ALGDMLYILC GTILEHGMQY KIEEVFEEIQ RSNMSKLGAD GKPIYREDGK VLKGPNYFKP       120
     NIESILDK                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page