(data stored in ACNUC7421 zone)

EMBL: CP002157.PE499

CP002157.PE499       Location/Qualifiers
FT   CDS             527582..528022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01187"
FT                   /product="P-II family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01187"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99945"
FT                   /db_xref="GOA:A4AVL5"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVL5"
FT                   /protein_id="EAQ99945.1"
FT                   /translation="MGVNYYNHNYIIYTPIFLGVYHNKIYIWIFKQQIMKQIEAIIRKS
FT                   KFDDVKKALHQIEVNFFSYWDVTGVGNEKQGHVYRGISYSTSDIQRRYLSIVVSDEFLE
FT                   RTVETILESAYTGNVGDGKVFVSEILEAYRIRTKENGKTGIN"
     MGVNYYNHNY IIYTPIFLGV YHNKIYIWIF KQQIMKQIEA IIRKSKFDDV KKALHQIEVN        60
     FFSYWDVTGV GNEKQGHVYR GISYSTSDIQ RRYLSIVVSD EFLERTVETI LESAYTGNVG       120
     DGKVFVSEIL EAYRIRTKEN GKTGIN                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page