(data stored in ACNUC7421 zone)

EMBL: CP002157.PE5

CP002157.PE5         Location/Qualifiers
FT   CDS             complement(14101..15054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16156"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00634"
FT                   /db_xref="InterPro:IPR019861"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT64"
FT                   /protein_id="EAR00634.1"
FT                   /translation="MRLRNSILGFILVVILSLHEITAQQDAQYTQYMFNTMSVNPAYAG
FT                   SRGQLSIAALYRSQWVGLNGAPKSQTLNLHSPIRDSKLGYGISIVNDEIGDGVVQETYF
FT                   DAIVSYTIDVSLDGKLSFGLKAGGNLLNLDFQGLRNFDVEPISVDNIENKFSPNVGVGV
FT                   YYHTNSFYAGLSAPNLLQTEHFDNGQTDSNSVQFLSKERINFYMITGYVLDLNGNLKFK
FT                   PAVLTKVVGGAPLQVDLSASFMFNDKFTFGAAYRWDAAISGMVGFQISDQLMLGLAYDR
FT                   ETTDLGGTQFNDGSFEVFLRYELVKSFRNLVSPRFF"
     MRLRNSILGF ILVVILSLHE ITAQQDAQYT QYMFNTMSVN PAYAGSRGQL SIAALYRSQW        60
     VGLNGAPKSQ TLNLHSPIRD SKLGYGISIV NDEIGDGVVQ ETYFDAIVSY TIDVSLDGKL       120
     SFGLKAGGNL LNLDFQGLRN FDVEPISVDN IENKFSPNVG VGVYYHTNSF YAGLSAPNLL       180
     QTEHFDNGQT DSNSVQFLSK ERINFYMITG YVLDLNGNLK FKPAVLTKVV GGAPLQVDLS       240
     ASFMFNDKFT FGAAYRWDAA ISGMVGFQIS DQLMLGLAYD RETTDLGGTQ FNDGSFEVFL       300
     RYELVKSFRN LVSPRFF                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page