(data stored in ACNUC7421 zone)

EMBL: CP002157.PE502

CP002157.PE502       Location/Qualifiers
FT   CDS             complement(530477..531133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01202"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99948"
FT                   /db_xref="InterPro:IPR012467"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVL8"
FT                   /protein_id="EAQ99948.1"
FT                   /translation="MKYLVFGLFMLSVFFSCKDGKKYHDEKQNEKEFVKVDALNEILNF
FT                   QSNLNEEFKNPDTSPLADRFRKDFETLDFYEPDTTYIVRAKFVLTPEALPFLMPTTTDR
FT                   KSEEVVYGIAHFKLNGIEHKLEVYQNKKLMLEDEYRDYLFLPFLDGTNGDETYPGGRYI
FT                   DLSIPSDDTIVIDFNKAYNPYCAYNKKYSCPIVPGVNSLNTEVRAGVKDFKYGKE"
     MKYLVFGLFM LSVFFSCKDG KKYHDEKQNE KEFVKVDALN EILNFQSNLN EEFKNPDTSP        60
     LADRFRKDFE TLDFYEPDTT YIVRAKFVLT PEALPFLMPT TTDRKSEEVV YGIAHFKLNG       120
     IEHKLEVYQN KKLMLEDEYR DYLFLPFLDG TNGDETYPGG RYIDLSIPSD DTIVIDFNKA       180
     YNPYCAYNKK YSCPIVPGVN SLNTEVRAGV KDFKYGKE                               218
//

If you have problems or comments...

PBIL Back to PBIL home page