(data stored in ACNUC7421 zone)

EMBL: CP002157.PE504

CP002157.PE504       Location/Qualifiers
FT   CDS             532551..533288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01212"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99950"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVM0"
FT                   /protein_id="EAQ99950.1"
FT                   /translation="MRTILLTIFICLFFLGCNFKKDSQTTVVENKRHLPKLEQNRYNVA
FT                   FLIMDGTYNTEFTAPFDIFQHTQFRKGIKAMNTFTVANTLDPITTFEGVRVLPDFDYTN
FT                   DSLPHIDILVVPSAEHHLDSDLKDNQMLNFIKKVDENALYMTSHCDGAFVLAQAGVLDD
FT                   VTSTTFPSDIALYRKTFPQLSVEDNVLFVHDGKYITSAGGAKSFEAALYLCEVLYGKEI
FT                   TESLAKGLVIDWDITKVSHLTLQ"
     MRTILLTIFI CLFFLGCNFK KDSQTTVVEN KRHLPKLEQN RYNVAFLIMD GTYNTEFTAP        60
     FDIFQHTQFR KGIKAMNTFT VANTLDPITT FEGVRVLPDF DYTNDSLPHI DILVVPSAEH       120
     HLDSDLKDNQ MLNFIKKVDE NALYMTSHCD GAFVLAQAGV LDDVTSTTFP SDIALYRKTF       180
     PQLSVEDNVL FVHDGKYITS AGGAKSFEAA LYLCEVLYGK EITESLAKGL VIDWDITKVS       240
     HLTLQ                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page