(data stored in ACNUC7421 zone)

EMBL: CP002157.PE505

CP002157.PE505       Location/Qualifiers
FT   CDS             complement(533275..534687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01217"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01217"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99951"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVM1"
FT                   /protein_id="EAQ99951.1"
FT                   /translation="MKKILLVLTLSVSFLSSAQQLTLKKGMIMDRIAVNDTISEDFALF
FT                   LPTKFDTAKVWPVIFVFDMQGRGKKVLSMLSGAAEKNNYIIAASNKVNDTLSITQNVLI
FT                   TKRMFDAVFSMFRIHKERIYTAGFDGGARMASAMPIFLNNIKGVISCGASVGNRDLLSS
FT                   KKRFHFIGIVGNEDFNYPEIRKQESLFNLMKFPNETLVFDGGHKWPSQQLLSRAIEIFD
FT                   LEAMSKNIIPRDSVFIKDTYLRDLNNTNNLISENRFLIAHQKLEDILKIYRPLLKVDSL
FT                   KNSLKTIRRSQAFKSQKRNQNSVLFKESFVKSEYDYALEEDVFTYNYNNLGWWNYQMGV
FT                   LKKFKESDNISQRQMGVRLEGYLNALIADSIDIINENSPIDEEGLNYLWMLKTITTPDD
FT                   FSYYLKVISLNAKVEDYGTSLYYLEELLKLGYSNSDELYSLENTALFRITPEFNKLVEK
FT                   YLKKARYEIIEE"
     MKKILLVLTL SVSFLSSAQQ LTLKKGMIMD RIAVNDTISE DFALFLPTKF DTAKVWPVIF        60
     VFDMQGRGKK VLSMLSGAAE KNNYIIAASN KVNDTLSITQ NVLITKRMFD AVFSMFRIHK       120
     ERIYTAGFDG GARMASAMPI FLNNIKGVIS CGASVGNRDL LSSKKRFHFI GIVGNEDFNY       180
     PEIRKQESLF NLMKFPNETL VFDGGHKWPS QQLLSRAIEI FDLEAMSKNI IPRDSVFIKD       240
     TYLRDLNNTN NLISENRFLI AHQKLEDILK IYRPLLKVDS LKNSLKTIRR SQAFKSQKRN       300
     QNSVLFKESF VKSEYDYALE EDVFTYNYNN LGWWNYQMGV LKKFKESDNI SQRQMGVRLE       360
     GYLNALIADS IDIINENSPI DEEGLNYLWM LKTITTPDDF SYYLKVISLN AKVEDYGTSL       420
     YYLEELLKLG YSNSDELYSL ENTALFRITP EFNKLVEKYL KKARYEIIEE                  470
//

If you have problems or comments...

PBIL Back to PBIL home page