(data stored in ACNUC7421 zone)

EMBL: CP002157.PE507

CP002157.PE507       Location/Qualifiers
FT   CDS             complement(535641..536093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01227"
FT                   /product="probable transcriptional regulatory protein, AsnC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01227"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99953"
FT                   /db_xref="GOA:A4AVM3"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVM3"
FT                   /protein_id="EAQ99953.1"
FT                   /translation="MNSLNTSIDDLNWRILECLQENARESFASIGRKVGLTPPAVAERV
FT                   KKLEDLGVILGYKSTVSHTLTGHQLKAIITLRAFMGKLKPFLATVGKFKEVINCYRVTG
FT                   NENIVMEVVLKDQFHLEKFIDKLIQYGETRTHIILSDVISSAPINK"
     MNSLNTSIDD LNWRILECLQ ENARESFASI GRKVGLTPPA VAERVKKLED LGVILGYKST        60
     VSHTLTGHQL KAIITLRAFM GKLKPFLATV GKFKEVINCY RVTGNENIVM EVVLKDQFHL       120
     EKFIDKLIQY GETRTHIILS DVISSAPINK                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page