(data stored in ACNUC7421 zone)

EMBL: CP002157.PE514

CP002157.PE514       Location/Qualifiers
FT   CDS             545612..546487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01262"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99960"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVN0"
FT                   /protein_id="EAQ99960.1"
FT                   /translation="MKRIIKLIALPCILLGFISCEDEDKARITPYADETQGAFLRTIDA
FT                   GGVINRTDIAGSSYSITGELVAASNDDVSNVEIMVEFVDRTTDDDPGTNDDESIDPVLV
FT                   ASADVSTFVSNSNGLPETTFDIGISDATTALGLDLGDIEGGDQFLFWVVINMQDGTKFE
FT                   KGNSGDSVTGELFFSSPMVYTGSVVCILPMPPAGDWIIEMVDSYGDGWDGAFITATING
FT                   TGTDYTATDFGTNHTVNVPQGSSSLIFTYTPGNFESEHSFTIKAPSGNIVSEQGPGPTA
FT                   GEITLNLCNE"
     MKRIIKLIAL PCILLGFISC EDEDKARITP YADETQGAFL RTIDAGGVIN RTDIAGSSYS        60
     ITGELVAASN DDVSNVEIMV EFVDRTTDDD PGTNDDESID PVLVASADVS TFVSNSNGLP       120
     ETTFDIGISD ATTALGLDLG DIEGGDQFLF WVVINMQDGT KFEKGNSGDS VTGELFFSSP       180
     MVYTGSVVCI LPMPPAGDWI IEMVDSYGDG WDGAFITATI NGTGTDYTAT DFGTNHTVNV       240
     PQGSSSLIFT YTPGNFESEH SFTIKAPSGN IVSEQGPGPT AGEITLNLCN E                291
//

If you have problems or comments...

PBIL Back to PBIL home page