(data stored in ACNUC7421 zone)

EMBL: CP002157.PE515

CP002157.PE515       Location/Qualifiers
FT   CDS             complement(546777..547289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01267"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99961"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVN1"
FT                   /protein_id="EAQ99961.1"
FT                   /translation="MKKLRTHFLICFLLIFGFSGIAQDSCNCCSENHKAFDFWIGSWDV
FT                   VNPDGSAAGKSTIVKSEGDCVVRENWVSAKDGYTGTSTNFYNKVAEEWEQLWVDNSGAH
FT                   LKLKGNRKKNQMILSSTEVKNKSGVLIKNRITWTSNDDGTVRQLWEITHEGKVISVAFD
FT                   GLYKKVE"
     MKKLRTHFLI CFLLIFGFSG IAQDSCNCCS ENHKAFDFWI GSWDVVNPDG SAAGKSTIVK        60
     SEGDCVVREN WVSAKDGYTG TSTNFYNKVA EEWEQLWVDN SGAHLKLKGN RKKNQMILSS       120
     TEVKNKSGVL IKNRITWTSN DDGTVRQLWE ITHEGKVISV AFDGLYKKVE                  170
//

If you have problems or comments...

PBIL Back to PBIL home page