(data stored in ACNUC7421 zone)

EMBL: CP002157.PE519

CP002157.PE519       Location/Qualifiers
FT   CDS             complement(549357..550433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01287"
FT                   /product="peptide chain release factor 1"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01287"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99965"
FT                   /db_xref="GOA:A4AVN5"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVN5"
FT                   /protein_id="EAQ99965.1"
FT                   /translation="MIDKLNIVKQRFDEVSDLIIQPDVISDQKRYVQLTKEYKDLKDLM
FT                   EKRDAYVELTNNIQEAEEIISDGSDAEMLEMAKMQLDEAKTALPKLEEDIKLMLIPKDP
FT                   EDAKDVVVEIRAGTGGDEASIFAGDLFRMYTKYCEGRGWKTNVIDLSEGTSGGYKEIQF
FT                   EVSGADVYGTLKFEAGVHRVQRVPQTETQGRVHTSAATVMVLPEAEDFDVQIDPKDVRI
FT                   DFFCSSGPGGQSVNTTYSAVRLTHIPTGLVAQCQDQKSQHKNKDKAFRVLRSRLYDLEL
FT                   ARKQEEDAAKRNSQVSSGDRSAKIRTYNYAQGRVTDHRIGLTLYDLQNIINGDIQKIID
FT                   ELSLVENTEKLKEASEIF"
     MIDKLNIVKQ RFDEVSDLII QPDVISDQKR YVQLTKEYKD LKDLMEKRDA YVELTNNIQE        60
     AEEIISDGSD AEMLEMAKMQ LDEAKTALPK LEEDIKLMLI PKDPEDAKDV VVEIRAGTGG       120
     DEASIFAGDL FRMYTKYCEG RGWKTNVIDL SEGTSGGYKE IQFEVSGADV YGTLKFEAGV       180
     HRVQRVPQTE TQGRVHTSAA TVMVLPEAED FDVQIDPKDV RIDFFCSSGP GGQSVNTTYS       240
     AVRLTHIPTG LVAQCQDQKS QHKNKDKAFR VLRSRLYDLE LARKQEEDAA KRNSQVSSGD       300
     RSAKIRTYNY AQGRVTDHRI GLTLYDLQNI INGDIQKIID ELSLVENTEK LKEASEIF         358
//

If you have problems or comments...

PBIL Back to PBIL home page