(data stored in ACNUC7421 zone)

EMBL: CP002157.PE52

CP002157.PE52        Location/Qualifiers
FT   CDS             65796..66188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16391"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16391"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00681"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATB1"
FT                   /protein_id="EAR00681.1"
FT                   /translation="MHIETPKRTVNKSSQEVFEFLTKLENFEKLMPENIDKFEVINEDR
FT                   FLFALKGMPEIVLQRNEQHPNNKIVLGAASDKLPFTLTADIIELGENESEIILSFAGEF
FT                   NAMMAMMIKSPITKFMGTLSENLDSI"
     MHIETPKRTV NKSSQEVFEF LTKLENFEKL MPENIDKFEV INEDRFLFAL KGMPEIVLQR        60
     NEQHPNNKIV LGAASDKLPF TLTADIIELG ENESEIILSF AGEFNAMMAM MIKSPITKFM       120
     GTLSENLDSI                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page