(data stored in ACNUC7421 zone)

EMBL: CP002157.PE531

CP002157.PE531       Location/Qualifiers
FT   CDS             561936..563648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01347"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01347"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99977"
FT                   /db_xref="GOA:A4AVP7"
FT                   /db_xref="InterPro:IPR008756"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVP7"
FT                   /protein_id="EAQ99977.1"
FT                   /translation="MEALFIYLLKASGILTIFYLAYQVFLKRETFFSVNRHFLILGILT
FT                   ALLLPFITITNYVEISSVPMVFSENVASNTPINAVEQFNWVSLLFGIYIAGLLIFTTRL
FT                   FIQIGSLIKLIKKNKIAKQGKFYYVETNKNIAPFSFFNHIFYNPSLYSNSELSSILKHE
FT                   KAHSSQWHSIDVLLSHLITIFTWINPFSWLYQANIKQNLEFLADDSATKEVPSIKKYQY
FT                   TLLKVSGNQFYTPIVNNFYNSLIKKRIVMLNKSKSNKRNIFKVALILPALAVFLLSFNT
FT                   KNVYIPMDPAIGAQTNNEYATGLIKIIIDKKTTDKELSKIKKDLAKKGVDFSYTVVHNS
FT                   KNEITDISVDFATTAKDGKKMKSSSSFSNGDDGIDPIHIAYDEDTNTISMGSKAGVHAD
FT                   IHEDEEIHVDVHADSDKTIWVHADSDGEGHKTIEIIDENGEETIKINGKEVSRKEYDKL
FT                   KTEDGLHEKHFKIRKSHGDEDKNVFIMTDSDHDGDMDIKVISKKKDGFFFVNSDGDKKP
FT                   LYIIDGKESKEKDMKFLNPSEIESINVLKGESAKTLYGKKGKNGVIQIKTKKE"
     MEALFIYLLK ASGILTIFYL AYQVFLKRET FFSVNRHFLI LGILTALLLP FITITNYVEI        60
     SSVPMVFSEN VASNTPINAV EQFNWVSLLF GIYIAGLLIF TTRLFIQIGS LIKLIKKNKI       120
     AKQGKFYYVE TNKNIAPFSF FNHIFYNPSL YSNSELSSIL KHEKAHSSQW HSIDVLLSHL       180
     ITIFTWINPF SWLYQANIKQ NLEFLADDSA TKEVPSIKKY QYTLLKVSGN QFYTPIVNNF       240
     YNSLIKKRIV MLNKSKSNKR NIFKVALILP ALAVFLLSFN TKNVYIPMDP AIGAQTNNEY       300
     ATGLIKIIID KKTTDKELSK IKKDLAKKGV DFSYTVVHNS KNEITDISVD FATTAKDGKK       360
     MKSSSSFSNG DDGIDPIHIA YDEDTNTISM GSKAGVHADI HEDEEIHVDV HADSDKTIWV       420
     HADSDGEGHK TIEIIDENGE ETIKINGKEV SRKEYDKLKT EDGLHEKHFK IRKSHGDEDK       480
     NVFIMTDSDH DGDMDIKVIS KKKDGFFFVN SDGDKKPLYI IDGKESKEKD MKFLNPSEIE       540
     SINVLKGESA KTLYGKKGKN GVIQIKTKKE                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page