(data stored in ACNUC7421 zone)

EMBL: CP002157.PE538

CP002157.PE538       Location/Qualifiers
FT   CDS             complement(571714..574830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01382"
FT                   /product="putative outer membrane protein probably involved
FT                   in nutrient binding"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01382"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99984"
FT                   /db_xref="GOA:A4AVQ4"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR023996"
FT                   /db_xref="InterPro:IPR023997"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVQ4"
FT                   /protein_id="EAQ99984.1"
FT                   /translation="MNQKFKYLLLFVALLFIQGAVAQTISGTITDGDSGMPIPGANVIE
FT                   KGTTNGVATDFDGNYTIEVSDSAATLVFSTLGFTSQEISISGRTTINVVLMVDAEMLDE
FT                   VVVTALGIKRERKSLGYAVQEIKGASIVDAREPNMVNALSGKITGLQVIKGSNGPAGSS
FT                   KIVLRGYSSLTGDNQPLIVVDGTPLDNFTGSSSEGFWSPSADLGNGLADVNPDDIESLS
FT                   VLKGASAAALYGSRAGNGVILITTKTGKSNQGLGISYSATTGFQTIFTKPELQSSFGQG
FT                   SLGAYGEYDSTSWGPRISGQTETGPEQGSVVFDKAYDNVGNYYKNGLSQNHSISIQNQT
FT                   DSGSYYTSANYLDDEGISPSATLERLNMTARGVSKFGKDKKWTVDTKVQYNKTTANNRP
FT                   RTGFGSLSQYQTIINFPRSRDITQYSDGVDEFGNQVWYDPNSSQINPYWANERRLSWDS
FT                   RDRFILTGSLKHEFNDWLNAEVRGGVDMYTTNTESKVFAGTSSNSTYGLGKSTFNEQNY
FT                   SALLVAAKDNIFGKLGGSVTLGGNLMNTENSRISSNSGTLLVPNLFSLNNGVNPASVSQ
FT                   GFSEKKINSLYGLFQINYDGYFFIDVTGRNDWTSTLSEENRSFFYSSASASLVISDMIT
FT                   NNGGELPSWFTFGKLRGSYAEVGNDLSPYQLYNSFSIGNDSQGNTTASTNNTLLNPDVV
FT                   NELIKSVEFGLDARFFNNRVGLDIAWYKSNATNQLIDLPLDPFSGFNSKKINAGDIQNK
FT                   GVEATLKTKILDNDDGLSWHMDVNYSKNENTIEELADDVTEYTLGGFDNFRIRADVGGD
FT                   YGVIVGTKFLRVEDEASPFFGRILVDGEGLPLATADRHVLGSQVPDALLGVTNMFTYRN
FT                   FAFSFLFSASIGGEIFSGTNHALQRSGLAAVTTVNGDRGDIVVDGVVDDGAGNLSENTV
FT                   GATPQNYWAAITGRSGNLGINEANVYDATHYRLRNVNLTYTFDNKFLDRTPFKGLSVGV
FT                   SANNVWMISNNLNGVDPEAVNGTRSNANGFENLAPPTTRTVFFNVAAKF"
     MNQKFKYLLL FVALLFIQGA VAQTISGTIT DGDSGMPIPG ANVIEKGTTN GVATDFDGNY        60
     TIEVSDSAAT LVFSTLGFTS QEISISGRTT INVVLMVDAE MLDEVVVTAL GIKRERKSLG       120
     YAVQEIKGAS IVDAREPNMV NALSGKITGL QVIKGSNGPA GSSKIVLRGY SSLTGDNQPL       180
     IVVDGTPLDN FTGSSSEGFW SPSADLGNGL ADVNPDDIES LSVLKGASAA ALYGSRAGNG       240
     VILITTKTGK SNQGLGISYS ATTGFQTIFT KPELQSSFGQ GSLGAYGEYD STSWGPRISG       300
     QTETGPEQGS VVFDKAYDNV GNYYKNGLSQ NHSISIQNQT DSGSYYTSAN YLDDEGISPS       360
     ATLERLNMTA RGVSKFGKDK KWTVDTKVQY NKTTANNRPR TGFGSLSQYQ TIINFPRSRD       420
     ITQYSDGVDE FGNQVWYDPN SSQINPYWAN ERRLSWDSRD RFILTGSLKH EFNDWLNAEV       480
     RGGVDMYTTN TESKVFAGTS SNSTYGLGKS TFNEQNYSAL LVAAKDNIFG KLGGSVTLGG       540
     NLMNTENSRI SSNSGTLLVP NLFSLNNGVN PASVSQGFSE KKINSLYGLF QINYDGYFFI       600
     DVTGRNDWTS TLSEENRSFF YSSASASLVI SDMITNNGGE LPSWFTFGKL RGSYAEVGND       660
     LSPYQLYNSF SIGNDSQGNT TASTNNTLLN PDVVNELIKS VEFGLDARFF NNRVGLDIAW       720
     YKSNATNQLI DLPLDPFSGF NSKKINAGDI QNKGVEATLK TKILDNDDGL SWHMDVNYSK       780
     NENTIEELAD DVTEYTLGGF DNFRIRADVG GDYGVIVGTK FLRVEDEASP FFGRILVDGE       840
     GLPLATADRH VLGSQVPDAL LGVTNMFTYR NFAFSFLFSA SIGGEIFSGT NHALQRSGLA       900
     AVTTVNGDRG DIVVDGVVDD GAGNLSENTV GATPQNYWAA ITGRSGNLGI NEANVYDATH       960
     YRLRNVNLTY TFDNKFLDRT PFKGLSVGVS ANNVWMISNN LNGVDPEAVN GTRSNANGFE      1020
     NLAPPTTRTV FFNVAAKF                                                    1038
//

If you have problems or comments...

PBIL Back to PBIL home page