(data stored in ACNUC7421 zone)

EMBL: CP002157.PE553

CP002157.PE553       Location/Qualifiers
FT   CDS             598154..599188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01457"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01457"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99999"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVR9"
FT                   /protein_id="EAQ99999.1"
FT                   /translation="MNRRNFIQNTSLASGGLLAGMPILNAMAPFKDVIIGHNSHQYKID
FT                   MNWGALNSNFYPVNDCHEMVQDSKGRIILLTNHTKNNVIVYDKSGKLIEVWGTDYPGAH
FT                   GLTLNVENGEDVLYISDNARHEVIKTTIDGKVIQVFTYPKESGKYDKKELYVPTETAIA
FT                   ANGDVYIADGYGEQFIMHYNAKGELLNTFGGKGEEDEKFNNAHGICIDTRNPSDPTLLI
FT                   TARQQNKLKRFTMDGKFIESSDLPGAYICRPVIHGTNVYLATIWSGDGSENTGFVSVLD
FT                   KDNKLISAPGGSTPNYVDGTLEHMHQTAKIFHHPHDVCVDDDENLYVAQWNSGKTYPIK
FT                   LFRV"
     MNRRNFIQNT SLASGGLLAG MPILNAMAPF KDVIIGHNSH QYKIDMNWGA LNSNFYPVND        60
     CHEMVQDSKG RIILLTNHTK NNVIVYDKSG KLIEVWGTDY PGAHGLTLNV ENGEDVLYIS       120
     DNARHEVIKT TIDGKVIQVF TYPKESGKYD KKELYVPTET AIAANGDVYI ADGYGEQFIM       180
     HYNAKGELLN TFGGKGEEDE KFNNAHGICI DTRNPSDPTL LITARQQNKL KRFTMDGKFI       240
     ESSDLPGAYI CRPVIHGTNV YLATIWSGDG SENTGFVSVL DKDNKLISAP GGSTPNYVDG       300
     TLEHMHQTAK IFHHPHDVCV DDDENLYVAQ WNSGKTYPIK LFRV                        344
//

If you have problems or comments...

PBIL Back to PBIL home page