(data stored in ACNUC7421 zone)

EMBL: CP002157.PE557

CP002157.PE557       Location/Qualifiers
FT   CDS             602913..603470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01477"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01477"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00003"
FT                   /db_xref="GOA:A4AVS3"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVS3"
FT                   /protein_id="EAR00003.1"
FT                   /translation="MNKGELNIKSSDLTSSEELNISYEEIDTSKLVYQKQTDNIMLIIT
FT                   IIFGGFFTINLFNPDNYKDDGWFGVGLFLFMVTLFSAMITYVKSKNLVLIPTMNNGYIE
FT                   ILKAKPNQKQFDEFLSELTIRITTYLKSKYGTLDFDLPTEPQLMNLSWLKDREIITLDE
FT                   FENLKKQLINNGKGNSPVGFNK"
     MNKGELNIKS SDLTSSEELN ISYEEIDTSK LVYQKQTDNI MLIITIIFGG FFTINLFNPD        60
     NYKDDGWFGV GLFLFMVTLF SAMITYVKSK NLVLIPTMNN GYIEILKAKP NQKQFDEFLS       120
     ELTIRITTYL KSKYGTLDFD LPTEPQLMNL SWLKDREIIT LDEFENLKKQ LINNGKGNSP       180
     VGFNK                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page