(data stored in ACNUC7421 zone)

EMBL: CP002157.PE565

CP002157.PE565       Location/Qualifiers
FT   CDS             609554..609832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01517"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01517"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00011"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVT1"
FT                   /protein_id="EAR00011.1"
FT                   /translation="MSILESIKSYFGKKMNNEKTGEAPEGVCPNCWGKQEWEGEFYEFM
FT                   KGSKNDKRDETYNNFINKIVESNIEGIRIQQDSYTCKTCNIKYDSDH"
     MSILESIKSY FGKKMNNEKT GEAPEGVCPN CWGKQEWEGE FYEFMKGSKN DKRDETYNNF        60
     INKIVESNIE GIRIQQDSYT CKTCNIKYDS DH                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page