(data stored in ACNUC7421 zone)

EMBL: CP002157.PE567

CP002157.PE567       Location/Qualifiers
FT   CDS             610216..610809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01527"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01527"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00013"
FT                   /db_xref="GOA:A4AVT3"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVT3"
FT                   /protein_id="EAR00013.1"
FT                   /translation="MKKKALLIIGSIGIIYFFVSYLLPNYIGVPLAAYESYKNRSEYEK
FT                   ENSGNRLNELVLDSIGDFPFPIGSVSDYEKVFSEGQILKLTEIISSYEQETTREIAIVS
FT                   VSSIEPYIDIQKYSTDLANEWGIGKAETNNGLLILFSKNLQEISISTGLGTEKILTDEI
FT                   CKKVIDSTIIPQFKNGKYLAGIEKGMAELTKQWD"
     MKKKALLIIG SIGIIYFFVS YLLPNYIGVP LAAYESYKNR SEYEKENSGN RLNELVLDSI        60
     GDFPFPIGSV SDYEKVFSEG QILKLTEIIS SYEQETTREI AIVSVSSIEP YIDIQKYSTD       120
     LANEWGIGKA ETNNGLLILF SKNLQEISIS TGLGTEKILT DEICKKVIDS TIIPQFKNGK       180
     YLAGIEKGMA ELTKQWD                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page