(data stored in ACNUC7421 zone)

EMBL: CP002157.PE570

CP002157.PE570       Location/Qualifiers
FT   CDS             612851..613393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01542"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00016"
FT                   /db_xref="GOA:A4AVT6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVT6"
FT                   /protein_id="EAR00016.1"
FT                   /translation="MEKEYLFKSERLGFRNWEENDLKELEIMNSDVEVMEHFPKTLAKK
FT                   ENKALFEKLRLHYKKHNHTYFATEILESGELIGFIGLVFQDYKTDFTPAVDIGWRLKKS
FT                   AWGKGFATEGAKKCIDFGFNKLNLDKIIAICTVKNSKSENVMKKIGMNKIGEFNHPKLK
FT                   EFPDLEKCICYGINKNM"
     MEKEYLFKSE RLGFRNWEEN DLKELEIMNS DVEVMEHFPK TLAKKENKAL FEKLRLHYKK        60
     HNHTYFATEI LESGELIGFI GLVFQDYKTD FTPAVDIGWR LKKSAWGKGF ATEGAKKCID       120
     FGFNKLNLDK IIAICTVKNS KSENVMKKIG MNKIGEFNHP KLKEFPDLEK CICYGINKNM       180
//

If you have problems or comments...

PBIL Back to PBIL home page