(data stored in ACNUC7421 zone)

EMBL: CP002157.PE572

CP002157.PE572       Location/Qualifiers
FT   CDS             614290..616392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01552"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01552"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00018"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVT8"
FT                   /protein_id="EAR00018.1"
FT                   /translation="MKKNIFISIAFVFCNLIINAQNRLYVSPLGNDLNPGTSELPLASL
FT                   TGARNVIREYKKKNVQSVSFVVTIADGIYTMKEPFVLTHEDGGTSEHPILYKAERGASP
FT                   IFSGGKKIGGFTIKENGVWETTIPESKYYKWRFDQLYVNNKRAVLARTPNIGFLKIGGV
FT                   AENIWERGTGRTPEKAQQILTFDKDDFESIQRLSDDDLELIRFRTYHKWDFTIRHIDKI
FT                   DKDSLALFTSGEGMKPWNPLKKDGRIVFENYESALDSAGEWFLNNEGILSYIPLPGQTP
FT                   ENTEVIAPVLENLISIKGDIANNKFVTHIKFEGLAFKHSHYRLPRTGFEPNQAATEIPS
FT                   SVMLVGAKNIAFSNCEISHTGQHAIWFGKGCSNSLLSQCYINNIGGGGIYLGDVAPLEG
FT                   VEHTHHIKLDNNIIHSGGQEFPPAVGIWVGHSSENEITHNDIGNFYYTGISVGWIWGYK
FT                   PSFAKRNKITYNNIHHIGWDLLSDMAAVYTLGKSEETVVSNNVIHHVHAYSYGGWGLYP
FT                   DEGSSDIVMENNLVYSTKTGGFHQHYGKNNTIRNNIFAYSKMYQAQCTRVEEHRSFNFS
FT                   NNIIVFDKGVVLNGAWNKIDIYMDSNLYWNTGGNTYDFNGKSFKEWQKSGNDINSIIKN
FT                   PNFKDAPNFDFRLRNNKSIRKINFRPFDFSKAGVYGGIEWIGKSKLPKHITEDFDKVVE
FT                   ENMNRD"
     MKKNIFISIA FVFCNLIINA QNRLYVSPLG NDLNPGTSEL PLASLTGARN VIREYKKKNV        60
     QSVSFVVTIA DGIYTMKEPF VLTHEDGGTS EHPILYKAER GASPIFSGGK KIGGFTIKEN       120
     GVWETTIPES KYYKWRFDQL YVNNKRAVLA RTPNIGFLKI GGVAENIWER GTGRTPEKAQ       180
     QILTFDKDDF ESIQRLSDDD LELIRFRTYH KWDFTIRHID KIDKDSLALF TSGEGMKPWN       240
     PLKKDGRIVF ENYESALDSA GEWFLNNEGI LSYIPLPGQT PENTEVIAPV LENLISIKGD       300
     IANNKFVTHI KFEGLAFKHS HYRLPRTGFE PNQAATEIPS SVMLVGAKNI AFSNCEISHT       360
     GQHAIWFGKG CSNSLLSQCY INNIGGGGIY LGDVAPLEGV EHTHHIKLDN NIIHSGGQEF       420
     PPAVGIWVGH SSENEITHND IGNFYYTGIS VGWIWGYKPS FAKRNKITYN NIHHIGWDLL       480
     SDMAAVYTLG KSEETVVSNN VIHHVHAYSY GGWGLYPDEG SSDIVMENNL VYSTKTGGFH       540
     QHYGKNNTIR NNIFAYSKMY QAQCTRVEEH RSFNFSNNII VFDKGVVLNG AWNKIDIYMD       600
     SNLYWNTGGN TYDFNGKSFK EWQKSGNDIN SIIKNPNFKD APNFDFRLRN NKSIRKINFR       660
     PFDFSKAGVY GGIEWIGKSK LPKHITEDFD KVVEENMNRD                             700
//

If you have problems or comments...

PBIL Back to PBIL home page