(data stored in ACNUC7421 zone)

EMBL: CP002157.PE578

CP002157.PE578       Location/Qualifiers
FT   CDS             complement(621154..621522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01582"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01582"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00024"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVU4"
FT                   /protein_id="EAR00024.1"
FT                   /translation="MSRKAIRLPKPDLMIPFATKKAAKIRRIKLSEKPENAFSGGSTRN
FT                   KTTATNAIIEAVKIERASSKTPMMAVKKIANKCQASGVRSQGMGRCQMMTPSSRVILLF
FT                   THSNLWLVDGWFTLVVLV"
     MSRKAIRLPK PDLMIPFATK KAAKIRRIKL SEKPENAFSG GSTRNKTTAT NAIIEAVKIE        60
     RASSKTPMMA VKKIANKCQA SGVRSQGMGR CQMMTPSSRV ILLFTHSNLW LVDGWFTLVV       120
     LV                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page