(data stored in ACNUC7421 zone)

EMBL: CP002157.PE580

CP002157.PE580       Location/Qualifiers
FT   CDS             622888..623586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01592"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01592"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00026"
FT                   /db_xref="InterPro:IPR019619"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVU6"
FT                   /protein_id="EAR00026.1"
FT                   /translation="MKKSVFLTFLCIMLFLPKVGQAQINEDKLGAWYMYFFDTSFKESQ
FT                   WGAQGDIQYRNWNLGGDLEQLLIRGGITYKPVNSAVKLTLGYGNITTGVFGSNTATTTE
FT                   SRIYQEALFPVQFGKRLFTNHRFRYEQRFVENQDFRTRYRYNLFLNIPLNKSVMEEKTI
FT                   YLAAYNELFINGQRDTGNENTVEIFDRNRFYLALGYIIKKGLKVQVGIMNQTTDNWSKK
FT                   QLQVSLHHKI"
     MKKSVFLTFL CIMLFLPKVG QAQINEDKLG AWYMYFFDTS FKESQWGAQG DIQYRNWNLG        60
     GDLEQLLIRG GITYKPVNSA VKLTLGYGNI TTGVFGSNTA TTTESRIYQE ALFPVQFGKR       120
     LFTNHRFRYE QRFVENQDFR TRYRYNLFLN IPLNKSVMEE KTIYLAAYNE LFINGQRDTG       180
     NENTVEIFDR NRFYLALGYI IKKGLKVQVG IMNQTTDNWS KKQLQVSLHH KI               232
//

If you have problems or comments...

PBIL Back to PBIL home page