(data stored in ACNUC7421 zone)

EMBL: CP002157.PE587

CP002157.PE587       Location/Qualifiers
FT   CDS             complement(630015..630818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01627"
FT                   /product="ribosomal protein L11 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01627"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00033"
FT                   /db_xref="GOA:A4AVV3"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVV3"
FT                   /protein_id="EAR00033.1"
FT                   /translation="MVSPLQPATDILIAELGAAGFESFVEKENGVQAYIQETDWHEGIL
FT                   EGVSILGNPLFEVSYVLKKIEQQNWNATWEQNFNPITVGNKCQVRAPFHEKSNTEFDIV
FT                   IEPKMSFGTGHHETTHMMLQFILDHDFNGKSVLDMGSGTGVLAILAAMKGASAVDAIDI
FT                   DNWCYLNAKENVERNGNQAVEVYEGDASLLTNQRYDVIIANINRNILLNDIPTYVKCLN
FT                   PKGQLFLSGFYKEDIPLISQKCNESGLKFEKNLENNNWVAVKYVF"
     MVSPLQPATD ILIAELGAAG FESFVEKENG VQAYIQETDW HEGILEGVSI LGNPLFEVSY        60
     VLKKIEQQNW NATWEQNFNP ITVGNKCQVR APFHEKSNTE FDIVIEPKMS FGTGHHETTH       120
     MMLQFILDHD FNGKSVLDMG SGTGVLAILA AMKGASAVDA IDIDNWCYLN AKENVERNGN       180
     QAVEVYEGDA SLLTNQRYDV IIANINRNIL LNDIPTYVKC LNPKGQLFLS GFYKEDIPLI       240
     SQKCNESGLK FEKNLENNNW VAVKYVF                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page