(data stored in ACNUC7421 zone)

EMBL: CP002157.PE589

CP002157.PE589       Location/Qualifiers
FT   CDS             complement(631721..632818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01637"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01637"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00035"
FT                   /db_xref="GOA:A4AVV5"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVV5"
FT                   /protein_id="EAR00035.1"
FT                   /translation="MKYLVAFSRVFVGVLFIISGFIKLNDPVGFSFKLEEYFSQGVLDL
FT                   PFLVPYALALSLFVVIFEVLLGVMLLIGFRAKFTLWSLLLMIVFFTFLTFYSAYFNKVT
FT                   DCGCFGDAVKLTPWESFTKDVVLLVFIVILFVGRKYVKPIFGSNAKRVITAISLVLCIL
FT                   YANHVLRHLPAIDFRPYKIGANIQEGMSVPEDAPKPIFDYAWKFNVNGEEKIIVTNGDY
FT                   PSVDGEFIEVETTEVQKGYELPVHDFTIEQNGEDFAASLLEEEKLMMIIAYDLRKSKLN
FT                   AFEEVKTVVDLAVDKGYKVIGMSASGPEQTDRLIQEYGLNMQFYFTDETTLKTIVRSNP
FT                   GALVLEKGTIKQKVHFNDINDLNFN"
     MKYLVAFSRV FVGVLFIISG FIKLNDPVGF SFKLEEYFSQ GVLDLPFLVP YALALSLFVV        60
     IFEVLLGVML LIGFRAKFTL WSLLLMIVFF TFLTFYSAYF NKVTDCGCFG DAVKLTPWES       120
     FTKDVVLLVF IVILFVGRKY VKPIFGSNAK RVITAISLVL CILYANHVLR HLPAIDFRPY       180
     KIGANIQEGM SVPEDAPKPI FDYAWKFNVN GEEKIIVTNG DYPSVDGEFI EVETTEVQKG       240
     YELPVHDFTI EQNGEDFAAS LLEEEKLMMI IAYDLRKSKL NAFEEVKTVV DLAVDKGYKV       300
     IGMSASGPEQ TDRLIQEYGL NMQFYFTDET TLKTIVRSNP GALVLEKGTI KQKVHFNDIN       360
     DLNFN                                                                   365
//

If you have problems or comments...

PBIL Back to PBIL home page