(data stored in ACNUC7421 zone)

EMBL: CP002157.PE59

CP002157.PE59        Location/Qualifiers
FT   CDS             71534..71800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16426"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16426"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00688"
FT                   /db_xref="GOA:A4ATB8"
FT                   /db_xref="InterPro:IPR000582"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR035984"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATB8"
FT                   /protein_id="EAR00688.1"
FT                   /translation="MKKETLLKNFEEAVEFLNSYKEPLPADLLLKLYAYYKIAKKNFDN
FT                   PGSKTPLINAFKANALIQAQDISREDAMKAYIKLVKKEIKTGS"
     MKKETLLKNF EEAVEFLNSY KEPLPADLLL KLYAYYKIAK KNFDNPGSKT PLINAFKANA        60
     LIQAQDISRE DAMKAYIKLV KKEIKTGS                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page