(data stored in ACNUC7421 zone)

EMBL: CP002157.PE590

CP002157.PE590       Location/Qualifiers
FT   CDS             complement(632815..633360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01642"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01642"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00036"
FT                   /db_xref="InterPro:IPR011630"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVV6"
FT                   /protein_id="EAR00036.1"
FT                   /translation="MQQTSEQYDAVIKTCRDLFQKKMKDYGSAWRILRLPSLTDQIFIK
FT                   AQRIRGLQQNEVRKVDEDERSEFIGIINYSIMALIQLEKGVVEQPDLSTKESLDLFNKH
FT                   ISMTKSLMEDKNHDYGEAWRDMRVSSLTDLILQKLLRVKQIEDNKGKTLVSEGIDANYQ
FT                   DMVNYAVFAMIHLNEETE"
     MQQTSEQYDA VIKTCRDLFQ KKMKDYGSAW RILRLPSLTD QIFIKAQRIR GLQQNEVRKV        60
     DEDERSEFIG IINYSIMALI QLEKGVVEQP DLSTKESLDL FNKHISMTKS LMEDKNHDYG       120
     EAWRDMRVSS LTDLILQKLL RVKQIEDNKG KTLVSEGIDA NYQDMVNYAV FAMIHLNEET       180
     E                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page