(data stored in ACNUC7421 zone)

EMBL: CP002157.PE592

CP002157.PE592       Location/Qualifiers
FT   CDS             634324..635136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01652"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01652"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00038"
FT                   /db_xref="GOA:A4AVV8"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVV8"
FT                   /protein_id="EAR00038.1"
FT                   /translation="MLILPKRQGLDFLNFLDFKITDIIDIILVAVLLYYIYKLVRGSVA
FT                   INIFIGIVIIWGFWKLTELLEMEMISSMVGGFMQVGLIALIIVFQQEIRKFLLMIGSTN
FT                   FANKRNFIKRFRFLKTDGIGTNIDVDAILGACEIMGESKTGAILVIKRNNSLDFVKSSG
FT                   DQMYVEVNQPILGSIFYKNSPLHDGAAVIEDNYVTATRVILPVSNERNIPLRFGLRHRA
FT                   AVGITERTDALALVVSEETGNISYIKNGEFVLFKDLTELGNMMKEDLI"
     MLILPKRQGL DFLNFLDFKI TDIIDIILVA VLLYYIYKLV RGSVAINIFI GIVIIWGFWK        60
     LTELLEMEMI SSMVGGFMQV GLIALIIVFQ QEIRKFLLMI GSTNFANKRN FIKRFRFLKT       120
     DGIGTNIDVD AILGACEIMG ESKTGAILVI KRNNSLDFVK SSGDQMYVEV NQPILGSIFY       180
     KNSPLHDGAA VIEDNYVTAT RVILPVSNER NIPLRFGLRH RAAVGITERT DALALVVSEE       240
     TGNISYIKNG EFVLFKDLTE LGNMMKEDLI                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page