(data stored in ACNUC7421 zone)

EMBL: CP002157.PE596

CP002157.PE596       Location/Qualifiers
FT   CDS             complement(638316..638726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01672"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01672"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00042"
FT                   /db_xref="GOA:A4AVW2"
FT                   /db_xref="InterPro:IPR025635"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVW2"
FT                   /protein_id="EAR00042.1"
FT                   /translation="MIQRVQSIFLLVVACISALLPIWLNLWKNADGNEVFAQTEMGTMI
FT                   AFYSSAVLAIVAIFLFKKRQNQFVVNRLNMILNLFLLGFFVYRSLNLSGETLVSEKGIG
FT                   MLIPVFSIVFLVLANRAIKKDEDLVKSVDRLR"
     MIQRVQSIFL LVVACISALL PIWLNLWKNA DGNEVFAQTE MGTMIAFYSS AVLAIVAIFL        60
     FKKRQNQFVV NRLNMILNLF LLGFFVYRSL NLSGETLVSE KGIGMLIPVF SIVFLVLANR       120
     AIKKDEDLVK SVDRLR                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page