(data stored in ACNUC7421 zone)

EMBL: CP002157.PE599

CP002157.PE599       Location/Qualifiers
FT   CDS             641468..642142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01687"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01687"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00045"
FT                   /db_xref="GOA:A4AVW5"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVW5"
FT                   /protein_id="EAR00045.1"
FT                   /translation="MFDFLAKNYFIPLYVAALIISLIRYRYYFESVLKYFPMFIAYTLV
FT                   TELIGILIRDFEGFQIVYEESYHYANYLVFNIYDVVFFIYFYSLFWRVVKNLKSRRIIM
FT                   YGALIYVIAAIVNPFFQNVLVFPQIYASTVGSIILIVAIFLYYNEIKKQKEKKRNLMVW
FT                   ISFGLLVFNLLFPFISLTARFDYDLYQRLFLRQIHYILIVIMYSCFVLGFLLMRQMRPK
FT                   EA"
     MFDFLAKNYF IPLYVAALII SLIRYRYYFE SVLKYFPMFI AYTLVTELIG ILIRDFEGFQ        60
     IVYEESYHYA NYLVFNIYDV VFFIYFYSLF WRVVKNLKSR RIIMYGALIY VIAAIVNPFF       120
     QNVLVFPQIY ASTVGSIILI VAIFLYYNEI KKQKEKKRNL MVWISFGLLV FNLLFPFISL       180
     TARFDYDLYQ RLFLRQIHYI LIVIMYSCFV LGFLLMRQMR PKEA                        224
//

If you have problems or comments...

PBIL Back to PBIL home page