(data stored in ACNUC7421 zone)

EMBL: CP002157.PE60

CP002157.PE60        Location/Qualifiers
FT   CDS             complement(71807..72571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16431"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16431"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00689"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATB9"
FT                   /protein_id="EAR00689.1"
FT                   /translation="MIRPYILAETNWKALENAKFDLAILPWGATEAHNYHLPYATDVYE
FT                   SDALAAESARLAWEKGSKVIVLPSIPFGVNTGQSDIYLDINLNPTTQLAILADVIEVLN
FT                   RQGIKKLLIFNSHGGNNFKPLVRELGLKFPEMFICFSNWFQSLNKTEYFDEEGDHADEM
FT                   ETSLMLYLRPDLVLPKKIWGLGSSKKFKIKSFSEGWVWAERKWSEVSEDTGIGNPMQST
FT                   TEKGERFFKDVTIKIGQFIHELSNSDLADQYE"
     MIRPYILAET NWKALENAKF DLAILPWGAT EAHNYHLPYA TDVYESDALA AESARLAWEK        60
     GSKVIVLPSI PFGVNTGQSD IYLDINLNPT TQLAILADVI EVLNRQGIKK LLIFNSHGGN       120
     NFKPLVRELG LKFPEMFICF SNWFQSLNKT EYFDEEGDHA DEMETSLMLY LRPDLVLPKK       180
     IWGLGSSKKF KIKSFSEGWV WAERKWSEVS EDTGIGNPMQ STTEKGERFF KDVTIKIGQF       240
     IHELSNSDLA DQYE                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page