(data stored in ACNUC7421 zone)

EMBL: CP002157.PE603

CP002157.PE603       Location/Qualifiers
FT   CDS             645523..645639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01711"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01711"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99636"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWM2"
FT                   /protein_id="EAQ99636.1"
FT                   /translation="MIMKVMAVGVTTPLVLPLIFMTMVGTTGAMEAIITHGF"
     MIMKVMAVGV TTPLVLPLIF MTMVGTTGAM EAIITHGF                                38
//

If you have problems or comments...

PBIL Back to PBIL home page