(data stored in ACNUC7421 zone)

EMBL: CP002157.PE606

CP002157.PE606       Location/Qualifiers
FT   CDS             646583..648085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01726"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01726"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99639"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWM5"
FT                   /protein_id="EAQ99639.1"
FT                   /translation="MKRYLTFIVILACTLVSAQNINDVLRFSHENLQGTARFQGMSGAF
FT                   GALGGDLSALSVNPAGSAVFNNGLVTISGTHYEMDNLANYFGTYSGIKTNDVDINQFGG
FT                   VFVFKSNGNSDWKKMAIAINYDIVQNFDDEFNIQGDSNQGIDNYFLSFAQGVPFGSILL
FT                   QDGEYIEDGYLDIGSNQGFGDQQAFLGYYGGILDPEDQDEATTTYNSNALYDNVNHNFL
FT                   RLTSGFNSKFTFNLASQYQDKLYLGASLNFHTIFYDQVDEFRENGYDTSSPIQNTDFFN
FT                   FLHTEGSGFSFTLGAIAKLNQSVRLGGSYQSPTWYRLTDDFSQRIDSDLADDDINFINF
FT                   DVVNLFEAYTIKTPAKLTGSMALVFGKEGLLSFDYGYQDMSQAELRPTSDSSFATINSE
FT                   IANNLGAVSSFRLGGEYRVDQVSLRAGYRFEQSPYSDGNNIGDLTGYSGGLGYNFGGSK
FT                   LDLAVNRTEQDYNMQLFNTGITTPALINKINTNVTLSYTMNF"
     MKRYLTFIVI LACTLVSAQN INDVLRFSHE NLQGTARFQG MSGAFGALGG DLSALSVNPA        60
     GSAVFNNGLV TISGTHYEMD NLANYFGTYS GIKTNDVDIN QFGGVFVFKS NGNSDWKKMA       120
     IAINYDIVQN FDDEFNIQGD SNQGIDNYFL SFAQGVPFGS ILLQDGEYIE DGYLDIGSNQ       180
     GFGDQQAFLG YYGGILDPED QDEATTTYNS NALYDNVNHN FLRLTSGFNS KFTFNLASQY       240
     QDKLYLGASL NFHTIFYDQV DEFRENGYDT SSPIQNTDFF NFLHTEGSGF SFTLGAIAKL       300
     NQSVRLGGSY QSPTWYRLTD DFSQRIDSDL ADDDINFINF DVVNLFEAYT IKTPAKLTGS       360
     MALVFGKEGL LSFDYGYQDM SQAELRPTSD SSFATINSEI ANNLGAVSSF RLGGEYRVDQ       420
     VSLRAGYRFE QSPYSDGNNI GDLTGYSGGL GYNFGGSKLD LAVNRTEQDY NMQLFNTGIT       480
     TPALINKINT NVTLSYTMNF                                                   500
//

If you have problems or comments...

PBIL Back to PBIL home page